Bacterial taxon 273123
Protein WP_002212318.1
FKBP-type peptidyl-prolyl cis-trans isomerase
Yersinia pseudotuberculosis IP 32953
Gene fkpA, UniProt Q664Q9
>WP_002212318.1|Yersinia pseudotuberculosis IP 32953|FKBP-type peptidyl-prolyl cis-trans isomerase
MKSLFKVTLLATAMTLTLNTSTVFAADATSPVVTNSAFKNNDQQSAYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFANKSKLTDEEIEKTLQNFEARVKASAQAKMEQDAKENADKGAKYRDTFAKEKGVKKTASGLLYKVENAGTGDAPKDSDTVVVNYKGTLADGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKQIKKGGKITLVIPPELAYGKAGVPGIPANSTLIFDVELLDVKAAAKADAQEQQPAVDTKAKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.51 | -2.5148351127221 | 6.9e-42 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.5 | -2.5035344659676 | 2.0e-48 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.13 | -2.12528746782549 | 1.7e-37 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.56 | -0.563946433698093 | 0.02 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.3 ms
(Link to these results)