Host taxon 10090
Protein NP_032034.1
fibroblast growth factor 7 precursor
Mus musculus
Gene Fgf7, UniProt P36363
>NP_032034.1|Yersinia pseudotuberculosis IP 32953|fibroblast growth factor 7 precursor
MRKWILTRILPTLLYRSCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.17 | 2.16641494749187 | 2.5e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)