Host taxon 10090
Protein NP_032006.1
fatty acid-binding protein, intestinal
Mus musculus
Gene Fabp2, UniProt P55050
>NP_032006.1|Yersinia pseudotuberculosis IP 32953|fatty acid-binding protein, intestinal
MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFELGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNGKELIAVREVSGNELIQTYTYEGVEAKRFFKKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.75 | -4.74613273739322 | 1.0e-23 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)