Bacterial taxon 273123
Protein WP_002220756.1
F0F1 ATP synthase subunit gamma
Yersinia pseudotuberculosis IP 32953
Gene atpG, UniProt Q663Q7
>WP_002220756.1|Yersinia pseudotuberculosis IP 32953|F0F1 ATP synthase subunit gamma
MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKRLLAEMKGWSEKGVECDLALIGSKAASFFGSVGGKIVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVNNKFINTMSQEPRIMQLLPLPPAEDGELKKKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGASAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.93 | -2.93363916673186 | 3.6e-58 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.07 | -2.06890144913504 | 9.0e-20 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.87 | 1.87079600494758 | 5.3e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.66 | 1.66451525097764 | 3.8e-10 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.3 ms
(Link to these results)