Host taxon 10090
Protein NP_780608.1
exosome complex component RRP41
Mus musculus
Gene Exosc4, UniProt Q921I9
>NP_780608.1|Yersinia pseudotuberculosis IP 32953|exosome complex component RRP41
MAGLELLSDQGYRIDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDSRLHEDHLEQVLEAAAQAARGVHTLLDLVVRQHVQEASVSLGD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.68 | -0.680184125984784 | 0.049 | 28096329 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)