Host taxon 10090
Protein NP_031944.3
eukaryotic translation initiation factor 4E-binding protein 1
Mus musculus
Gene Eif4ebp1, UniProt Q60876
>NP_031944.3|Yersinia pseudotuberculosis IP 32953|eukaryotic translation initiation factor 4E-binding protein 1
MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.77 | 1.77360822898939 | 4.7e-10 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)