Host taxon 10090
Protein NP_031943.3
eukaryotic translation initiation factor 4E isoform 1
Mus musculus
Gene Eif4e, UniProt P63073
>NP_031943.3|Yersinia pseudotuberculosis IP 32953|eukaryotic translation initiation factor 4E isoform 1
MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.73 | 1.72831447740988 | 2.8e-9 | 28096329 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)