Host taxon 10090
Protein NP_001272871.1
eukaryotic translation initiation factor 3 subunit K isoform 2
Mus musculus
Gene Eif3k, UniProt Q9DBZ5
>NP_001272871.1|Yersinia pseudotuberculosis IP 32953|eukaryotic translation initiation factor 3 subunit K isoform 2
MAMFEQMRANVGKLLKGIDRYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.65 | -0.654942131886864 | 0.001 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)