Host taxon 10090
Protein NP_079713.2
eukaryotic translation initiation factor 1A, X-chromosomal
Mus musculus
Gene Eif1ax, UniProt Q8BMJ3
>NP_079713.2|Yersinia pseudotuberculosis IP 32953|eukaryotic translation initiation factor 1A, X-chromosomal
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.5 | 0.502302691657361 | 0.016 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)