Host taxon 10090
Protein NP_035638.1
eukaryotic translation initiation factor 1
Mus musculus
Gene Eif1, UniProt P48024
>NP_035638.1|Yersinia pseudotuberculosis IP 32953|eukaryotic translation initiation factor 1
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.11 | 1.10863550948397 | 2.9e-5 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)