Host taxon 10090
Protein NP_001309194.1
ETS domain-containing protein Elk-3 isoform Elk3c
Mus musculus
Gene Elk3, UniProt P41971
>NP_001309194.1|Yersinia pseudotuberculosis IP 32953|ETS domain-containing protein Elk-3 isoform Elk3c
MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPDILKMDPHAVEISRESLLLQDGDCKVSPEGREVHRHGLSSLKSASRNEYLHSGLYSSFTINSLQNAPEAFKAIKTEKLEEPCDDSPPVEEVRTVIRHQVDCFWPRVRCCPAYTSGAALVLSPH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.69 | 0.685444677862497 | 0.0011 | 28096329 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)