Host taxon 10090
Protein NP_034239.1
ephrin-A5 isoform 2 precursor
Mus musculus
Gene Efna5, UniProt O08543
>NP_034239.1|Yersinia pseudotuberculosis IP 32953|ephrin-A5 isoform 2 precursor
MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.61 | 1.60953423441222 | 2.0e-6 | 28096329 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)