Host taxon 10090
Protein NP_034237.3
ephrin-A1 isoform 1 precursor
Mus musculus
Gene Efna1, UniProt P52793
>NP_034237.3|Yersinia pseudotuberculosis IP 32953|ephrin-A1 isoform 1 precursor
MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.14 | -1.14002238788583 | 1.1e-5 | 28096329 | |
Retrieved 1 of 3 entries in 0.6 ms
(Link to these results)