Host taxon 10090
Protein NP_031928.2
endothelin-2 preproprotein
Mus musculus
Gene Edn2, UniProt P22389
>NP_031928.2|Yersinia pseudotuberculosis IP 32953|endothelin-2 preproprotein
MVSAWCSIALALLLALHEGKGQAAATLEQPASAPKGRGPHLRFRRCSCNSWLDKECVYFCHLDIIWVNTAGQTAPYGLGNPPRRRRRSLPKRCECSTAGDSACATFCHRRHWPEAVVAPSSQAPAAVLKTGKMWTAEGDLLRKLRDISATKLRFARLQPEVTRKAIPAYSRWRKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.16 | -3.15870676391527 | 0.0033 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)