Host taxon 10090
Protein NP_034234.1
endothelin-1 preproprotein
Mus musculus
Gene Edn1, UniProt P22387
>NP_034234.1|Yersinia pseudotuberculosis IP 32953|endothelin-1 preproprotein
MDYFPVIFSLLFVTFQGAPETAVLGAELSTGAENGVQSPPPSTPWRPRRSKRCSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGGSSRSKRSLKDLLPNKATDQAVRCQCAHQKDKKCWNFCQAGKELRAQSTMQKSLKDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIKASFRVAKLKAELYRDQKLTHNRAH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.87 | 1.86904250737243 | 0.0093 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)