Bacterial taxon 273123
Protein WP_011192605.1
endolytic transglycosylase MltG
Yersinia pseudotuberculosis IP 32953
Gene yceG, UniProt Q669L7
>WP_011192605.1|Yersinia pseudotuberculosis IP 32953|endolytic transglycosylase MltG
MKRKSTKALILFVVICLGLLLLGYQKVQDFARQPLAIKQETYFTLPVGTGRVALENLLLRDHVIANTGLFPWLLRIEPELANFKAGTYRFTPGMTVREMLELLVSGKEAQFTVRFIEGKRLRDWLDELQQSKYIKHVLEGKTDAEIAQLLGLKESEHPEGWLYPDTYSYTAGTTDLTLLKRAHQRMEKTVAEIWQGRDDGLPYKTPSDLVTMASIIEKETAVNEERDKVASVFINRLRLGMRLQTDPTVIYGMGEKYNGNITRKDLDTPTPYNTYVISGLPPTPIAMPGLASLTAAAHPAQTPYLYFVADGKGGHTFTTNLASHNQAVRVYRQSLKDKNEQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.45 | 1.44556509809102 | 0.00033 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.44 | 1.44186302670747 | 0.0004 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.43 | 1.4289457328084 | 0.003 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.22 | 1.2171548541771 | 0.016 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.7 ms
(Link to these results)