Host taxon 10090
Protein NP_083208.1
ELL-associated factor 1
Mus musculus
Gene Eaf1, UniProt Q9D4C5
>NP_083208.1|Yersinia pseudotuberculosis IP 32953|ELL-associated factor 1
MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQARMEQQPARPPQPSQPPPPPPPMPFRAPTKPPAGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSAGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSSQLMNTLRNDLQLSESGSDSDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.81 | 0.814005517765339 | 4.2e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)