Host taxon 10090
Protein NP_001076016.1
EG433016 protein
Mus musculus
Gene Cstdc4, UniProt B2RV77
>NP_001076016.1|Yersinia pseudotuberculosis IP 32953|EG433016 protein
MMPGGLSRARSATPEIQEIADKVKSLLEEKTNEKYEVFKAVEYKSQVVAGQNYFIKMDVGGGCFLHIKVFKGISGENVLELHGYQTNKTRKDELSYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 7.88 | 7.87530208242884 | 9.0e-21 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)