Bacterial taxon 273123
Protein WP_002208615.1
efflux RND transporter periplasmic adaptor subunit
Yersinia pseudotuberculosis IP 32953
Gene acrA, UniProt Q66DQ9
>WP_002208615.1|Yersinia pseudotuberculosis IP 32953|efflux RND transporter periplasmic adaptor subunit
MSKNRGVMPLAAILVLSGSLVLIGCNDKDAAQAGAQQAPEVGVVTLKAEPLNITTDLPGRTSAFRVAEVRPQVSGIILKRNYIEGSDVTAGTSLYQIDPATYQAAYDSAKGDLAKAQASAQIAHLTVNRYKPLLGTNYISKQEYDQALSDAQQADATVLAAKAALESARINLAYTQVRSPISGRTGKSAVTEGALVTSGQASAMTTVQQLDPMYVDVTQSSDEFLRLKKELADGILKQENGKAKVRLLLENGVEYTETGTLEFSGVTVDETTGSITLRAIFPNPNEALLPGMFVRARLDEGIRPDALLVPQQGVTRNPRGEATAMVVGAGNKVEMRTLIANQAIGNKWLVTEGLKAGDRLIISGLQKIKPGVEVKVQEVTDTAPETAPADTAKKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.98 | -1.97844495995448 | 6.0e-17 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.79 | -1.79245325140108 | 4.7e-16 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.08 | -1.07905487296128 | 0.00091 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.88 | -0.881229994717974 | 0.019 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.7 ms
(Link to these results)