Host taxon 10090
Protein NP_080577.1
E3 ubiquitin-protein ligase RNF125 isoform 1
Mus musculus
Gene Rnf125, UniProt Q9D9R0
>NP_080577.1|Yersinia pseudotuberculosis IP 32953|E3 ubiquitin-protein ligase RNF125 isoform 1
MKSEYQNCAECGTLVCLSDMRAHIRTCEKYIDKYGPLLELGDTTARCVCPFCQRELDEDCLLDHCIIHHRSERRPVFCPLCHSRPDESPSTFNGSLIRHLQVSHTLFYDDFIDFDIIEEAIIRRVLDRSLLEYVNQSNTT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.54 | 1.54084322052587 | 2.4e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)