Host taxon 10090
Protein NP_001104589.1
E3 ubiquitin-protein ligase CCNB1IP1
Mus musculus
Gene Ccnb1ip1, UniProt D3Z3K2
>NP_001104589.1|Yersinia pseudotuberculosis IP 32953|E3 ubiquitin-protein ligase CCNB1IP1
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEVVLDISSRALAFWTYQVHQERLYQEYNFSKAENHLKQMEKMYMQQIQSKNIELTSMKGEVISMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIASQEGSLEPGMIPQSGVFGFPPGNNSKFSLDHIPVGNQGGGDEDVQFRPFFVCSPTAPEPINNFFSFASPSHEAEQQVCSRAFKAKRI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.15 | 2.14528090129541 | 0.00077 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)