Host taxon 10090
Protein NP_001153037.1
dynactin subunit 3 isoform B
Mus musculus
Gene Dctn3, UniProt Q9Z0Y1
>NP_001153037.1|Yersinia pseudotuberculosis IP 32953|dynactin subunit 3 isoform B
MAALTDVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDLIKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVPEHAARLQRLAQIHIQQQFVQWDELLCQLEAAKQVKPAEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.77 | -0.774459684642496 | 0.018 | 28096329 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)