Host taxon 10090
Protein NP_001277437.1
dolichyldiphosphatase 1 isoform b
Mus musculus
Gene Dolpp1, UniProt Q9JMF7
>NP_001277437.1|Yersinia pseudotuberculosis IP 32953|dolichyldiphosphatase 1 isoform b
MPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAVAWFIITQEILTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.98 | -0.978417300192301 | 0.0033 | 28096329 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)