Host taxon 10090
Protein NP_033113.1
DNA-directed RNA polymerases I and III subunit RPAC2 isoform 1
Mus musculus
Gene Polr1d, UniProt P97304
>NP_033113.1|Yersinia pseudotuberculosis IP 32953|DNA-directed RNA polymerases I and III subunit RPAC2 isoform 1
MEDDQELERKISGLKTSMAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKDYKAKKASKKEPTF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.97 | 0.974660748390013 | 0.0089 | 28096329 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)