Host taxon 10090
Protein NP_001158265.1
DNA-directed RNA polymerase II subunit GRINL1A isoform 2
Mus musculus
Gene Polr2m, UniProt Q6P6I6
>NP_001158265.1|Yersinia pseudotuberculosis IP 32953|DNA-directed RNA polymerase II subunit GRINL1A isoform 2
MLDTSSLDPDCSSIDIKSSKSTSETQGPTHLTHRGNEETLEAGYTVNSSPAAHIRARAPSSEVKEHLPQHSVSSQEEEISSSIDSLFITKLQKITIADQSEPSEENTSTENFPELQSETPKKPHYMKVLEMRARNPVPPPHKFKTNVLPTQQSDSPSHCQRGQSPASSEEQRRRARQHLDDITAARLLPLHHLPAQLLSIEESLALQREQKQNYEEMQAKLAAQKLAERLNIKMQSYNPEGESSGRYREVRDEADAQSSDEC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.48 | 0.482819355242153 | 0.0025 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)