Bacterial taxon 273123
Protein WP_002209643.1
DNA replication/repair protein RecF
Yersinia pseudotuberculosis IP 32953
Gene recF, UniProt Q663T4
>WP_002209643.1|Yersinia pseudotuberculosis IP 32953|DNA replication/repair protein RecF
MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYTLGHGRAFRSLQAGRVIRHECAEFVLHGRVDANEREASVGLSKSRQGDTKVRIDGTDGHKVAELAQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQVSRYTQIRAWDQEIIPLAERISEWRAAYSDAIAADISATCALFLPEFALSFSFQRGWDKESDYGELLARQFERDRALTYTAVGPHKADFRIRADGTPVEDLLSRGQLKLLMCALRLAQGEFLTRQSGRRCLYLLDDFASELDTGRRRLLAERLKATQAQVFVSAVSAEQVADMVGEKGKMFRVEHGKIEVQPQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.31 | 2.30797694313496 | 0.0004 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.87 | 1.8717112013087 | 0.0063 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.76 | -1.75912499365527 | 3.6e-7 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.29 | -1.28722265092268 | 0.0021 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)