Host taxon 10090
Protein NP_001277112.1
DNA damage-inducible transcript 3 protein
Mus musculus
Gene Ddit3, UniProt P35639
>NP_001277112.1|Yersinia pseudotuberculosis IP 32953|DNA damage-inducible transcript 3 protein
MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.15 | 1.14759717593591 | 0.0013 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)