Bacterial taxon 273123
Protein WP_002215910.1
dipeptide/tripeptide permease DtpA
Yersinia pseudotuberculosis IP 32953
Gene dtpA, UniProt Q66A54
>WP_002215910.1|Yersinia pseudotuberculosis IP 32953|dipeptide/tripeptide permease DtpA
MSTANNNQPESISMNAFKQPKAFYLIFSIELWERFGYYGLQGIMAVYLVKMLGMSEADSITLFSSFSALVYGFVAIGGWLGDKVLGAKRVIVLGALTLAVGYSMIAYSGHEIFWVYLGMATIAVGNGLFKANPSSLLSTCYSKDDPRLDGAFTMYYMSINIGSFFSMLATPWLAAKYGWSVAFSLSVVGMLITLVNFWFCRKWVKNQGSKPDFLPLQFKKLLMVLVGIIALITLSNWLLHNQIIARWALALVSLGIIFIFTKETLFLQGIARRRMIVAFLLMLEAVIFFVLYSQMPTSLNFFAIHNVEHSIFGIGFEPEQFQALNPFWIMLASPILAAIYNKMGDRLPMPHKFAFGMMLCSAAFLVLPWGASFANEHGIVSVNWLILSYALQSIGELMISGLGLAMVAQLVPQRLMGFIMGSWFLTTAAAALIAGKVAALTAVPSDAITDAHASLAIYSHVFMQIGIVTAIIAVLMMLTAPKLYRMTLAPSDHNDVKIMTQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.88 | 1.88225034247318 | 0.00062 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.67 | 1.66940517616178 | 0.0018 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.07 | -1.06710229150827 | 0.003 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.8 | -0.803853902990165 | 0.013 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)