Host taxon 10090
Protein NP_001278794.1
diamine acetyltransferase 1 isoform 2
Mus musculus
Gene Sat1, UniProt P48026
>NP_001278794.1|Yersinia pseudotuberculosis IP 32953|diamine acetyltransferase 1 isoform 2
MYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAAEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.85 | 0.848527986314851 | 0.0021 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)