Host taxon 10090
Protein NP_062745.1
destrin
Mus musculus
Gene Dstn, UniProt Q9R0P5
>NP_062745.1|Yersinia pseudotuberculosis IP 32953|destrin
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIVVEEGKEILVGDVGATITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPEQAPLKSKMIYASSKDAIKKKFPGIKHEYQANGPEDLNRTCIAEKLGGSLIVAFEGSPV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.36 | -0.360515149933708 | 0.033 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)