Host taxon 10090
Protein NP_080879.1
density-regulated protein
Mus musculus
Gene Denr, UniProt Q9CQJ6
>NP_080879.1|Yersinia pseudotuberculosis IP 32953|density-regulated protein
MATDISESSGADCKGDTKNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQETGITEGQGPVGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.86 | 0.862408506809137 | 0.0043 | 28096329 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)