Host taxon 10090
Protein NP_075692.1
dCTP pyrophosphatase 1
Mus musculus
Gene Dctpp1, UniProt Q9QY93
>NP_075692.1|Yersinia pseudotuberculosis IP 32953|dCTP pyrophosphatase 1
MSTAGDGERGTVGQEDSAAARPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLSRGSACKYTDLPRGTISENQAVGAGDPASELRDQAST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.99 | -0.986026910582554 | 0.0013 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)