Host taxon 10090
Protein NP_084051.1
DCN1-like protein 5 isoform 2
Mus musculus
Gene Dcun1d5, UniProt Q9CXV9
>NP_084051.1|Yersinia pseudotuberculosis IP 32953|DCN1-like protein 5 isoform 2
MPVKKKRKAPGVAAAVAEDAGLKKCKIPSYCRSQPPARLISGEEDFSRKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQSRFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKIRQTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.9 | 0.904990678983797 | 0.00055 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)