Host taxon 10090
Protein NP_080911.1
cytosolic iron-sulfur assembly component 2A isoform 1 precursor
Mus musculus
Gene Ciao2a, UniProt Q9DCL2
>NP_080911.1|Yersinia pseudotuberculosis IP 32953|cytosolic iron-sulfur assembly component 2A isoform 1 precursor
MERVSGLLSWTLSRVLWLSGFSEHGAAWQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEINEDDYLVIIKFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.71 | 0.713839874287127 | 0.027 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)