Host taxon 10090
Protein NP_001304283.1
cytokine-inducible SH2-containing protein isoform 2
Mus musculus
Gene Cish, UniProt Q62225
>NP_001304283.1|Yersinia pseudotuberculosis IP 32953|cytokine-inducible SH2-containing protein isoform 2
MPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.81 | 0.808061370666469 | 0.037 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)