Host taxon 10090
Protein NP_631939.1
cytohesin-interacting protein
Mus musculus
Gene Cytip, UniProt Q91VY6
>NP_631939.1|Yersinia pseudotuberculosis IP 32953|cytohesin-interacting protein
MSLQRFLQRQGSNGNLEYCADSAYGSYSVLTGQLTMEDNRRIQVLADTVATLPRGRKQLALARSSSLGDFSWSQRKVVTVEKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKVQEDSPAHCAGLQVGDIFANVNGVSTEGFTHKQVVDLIRSSGNLLTIETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRSLHLQEQRLLHGDTANSPNLENMDLDESSLFGNLLGPSPALLDRHRLSSESSCKSWLSSLTVDSEDGYRSSMSEDSIRGAFSRQTSTDDECFHSKDGDEILRNASSRRNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHRAVEEEESRF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.54 | 0.544365785886924 | 0.0038 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)