Bacterial taxon 273123
Protein WP_002208651.1
cytochrome o ubiquinol oxidase subunit III
Yersinia pseudotuberculosis IP 32953
Gene cyoC, UniProt Q66DU3
>WP_002208651.1|Yersinia pseudotuberculosis IP 32953|cytochrome o ubiquinol oxidase subunit III
MSTETLTNHNVAHAEHGHHDAGATKVFGFWVYLMSDCILFATLFATYAVLVNGTAGGPSGKELFDLNFVLVETFLLLFSSITYGVAMLGMSKGSVKQVNTWLGFTFLFGLGFIAMELYEFHKLIEEGYGPARSGFLSAYFALVGTHGLHVTAGLAWIIIMMIQVARRGLNSTNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.12 | -3.11999574532382 | 7.4e-20 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.87 | -2.87267462549551 | 3.4e-14 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.36 | -1.36315539921936 | 0.013 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.36 | -1.35544936071779 | 0.014 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)