Host taxon 10090
Protein NP_035016.1
cytochrome c oxidase subunit NDUFA4
Mus musculus
Gene Ndufa4, UniProt Q62425
>NP_035016.1|Yersinia pseudotuberculosis IP 32953|cytochrome c oxidase subunit NDUFA4
MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNVDYSKLKKEGPDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.02 | -1.01504137822269 | 2.4e-9 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)