Host taxon 10090
Protein NP_079655.1
cytochrome c oxidase subunit 7B, mitochondrial precursor
Mus musculus
Gene Cox7b, UniProt P56393
>NP_079655.1|Yersinia pseudotuberculosis IP 32953|cytochrome c oxidase subunit 7B, mitochondrial precursor
MLPLAKNALSRLQVRSIQQVVARQSHQKRAPSFHDKYGNAILAGGAIFCVSTWTYTATQIGIEWNMSPVGRVTPKEWRDQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.94 | -0.939041686443736 | 6.1e-9 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)