Host taxon 10090
Protein NP_034074.1
cytochrome c oxidase subunit 7A1, mitochondrial precursor
Mus musculus
Gene Cox7a1, UniProt P56392
>NP_034074.1|Yersinia pseudotuberculosis IP 32953|cytochrome c oxidase subunit 7A1, mitochondrial precursor
MRALRVSQALVRSFSSSTRSHLENRVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLTLGGTAYCLYCLGWASFPHKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.51 | -2.51091635877368 | 2.6e-11 | 28096329 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)