Host taxon 10090
Protein NP_033213.1
cytochrome c oxidase subunit 7A-related protein, mitochondrial isoform 2
Mus musculus
Gene Cox7a2l, UniProt Q61387
>NP_033213.1|Yersinia pseudotuberculosis IP 32953|cytochrome c oxidase subunit 7A-related protein, mitochondrial isoform 2
MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLTSSVTAYDYSGKNKVPELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.77 | 1.76762233711376 | 0.0074 | 28096329 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)