Host taxon 10090
Protein NP_079917.1
cytochrome b-c1 complex subunit 6, mitochondrial
Mus musculus
Gene Uqcrh, UniProt P99028
>NP_079917.1|Yersinia pseudotuberculosis IP 32953|cytochrome b-c1 complex subunit 6, mitochondrial
MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.37 | -0.374524507432618 | 0.029 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)