Host taxon 10090
Protein NP_001268993.1
cytochrome b ascorbate-dependent protein 3 isoform 1
Mus musculus
Gene Cyb561a3, UniProt Q6P1H1
>NP_001268993.1|Yersinia pseudotuberculosis IP 32953|cytochrome b ascorbate-dependent protein 3 isoform 1
MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLFFVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHDRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.64 | -0.635567168868633 | 2.8e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)