Host taxon 10090
Protein NP_001263251.1
cysteine and histidine-rich protein 1 isoform 2
Mus musculus
Gene Cyhr1, UniProt Q9QXA1
>NP_001263251.1|Yersinia pseudotuberculosis IP 32953|cysteine and histidine-rich protein 1 isoform 2
MVSKPRTEWSTVLSHLVLAGVSLHAAVSSVQSSRGAAAGFLLQTFAAIIMLAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVLAVAGDHLGPEGCSVAGQAVLLVVAVTILIVAVFTANTYGMWGGTLLGVAGLLSRLEEDRLLLLPKEDVCRWALAAGSWAYCRALHTQRLQWE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.92 | -0.919719292811865 | 3.2e-8 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)