Host taxon 10090
Protein NP_082899.1
cystatin-M precursor
Mus musculus
Gene Cst6, UniProt Q9D1B1
>NP_082899.1|Yersinia pseudotuberculosis IP 32953|cystatin-M precursor
MERPHFPLAMGLGLLAFCLLTLSPDARAELRSRRTGERQNLSPTDPRVQKAAQAAVASYNMGSDSLYYFRDTKVIDAKYQLVAGIKYYLTLDIESTECRKTRVSGEHMDLTTCPLAAGGQQEKLRCNFELLEVPWKNTTQLLKHDCVQV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.78 | -1.77701263622406 | 1.4e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)