Host taxon 10090
Protein NP_034106.2
cystatin-C precursor
Mus musculus
Gene Cst3, UniProt P21460
>NP_034106.2|Yersinia pseudotuberculosis IP 32953|cystatin-C precursor
MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.18 | -1.17714390984646 | 1.1e-10 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)