Host taxon 10090
Protein NP_031819.1
cystatin-B
Mus musculus
Gene Cstb, UniProt Q62426
>NP_031819.1|Yersinia pseudotuberculosis IP 32953|cystatin-B
MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.86 | 1.8590953537893 | 8.4e-26 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)