Host taxon 10090
Protein NP_034005.2
cyclin-dependent kinase inhibitor 1B
Mus musculus
Gene Cdkn1b, UniProt P46414
>NP_034005.2|Yersinia pseudotuberculosis IP 32953|cyclin-dependent kinase inhibitor 1B
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.66 | 0.662042925816945 | 0.03 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)