Host taxon 10090
Protein NP_031696.1
cyclin-dependent kinase 4 inhibitor B
Mus musculus
Gene Cdkn2b, UniProt P55271
>NP_031696.1|Yersinia pseudotuberculosis IP 32953|cyclin-dependent kinase 4 inhibitor B
MLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.82 | -1.82026536537455 | 7.8e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)