Host taxon 10090
Protein NP_031524.2
cyclic AMP-dependent transcription factor ATF-3
Mus musculus
Gene Atf3, UniProt Q60765
>NP_031524.2|Yersinia pseudotuberculosis IP 32953|cyclic AMP-dependent transcription factor ATF-3
MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVNNRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.68 | 1.67587455068187 | 1.8e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)